Research Information Only — LL-37 is an investigational compound. No FDA-approved injectable formulation exists for human use. Content is for educational purposes only. Consult a qualified physician before use.
The only human cathelicidin — an endogenous antimicrobial peptide produced by neutrophils and epithelial cells that bridges innate immunity, wound healing, and adaptive immune regulation. Its tight linkage to Vitamin D3 makes it a central effector in the body's first-line defense against infection.
[LL-37, 37 aa]37 Amino Acids~4,493 DaOnly Human CathelicidinEndogenous PeptideVitamin D–RegulatedNot WADA Prohibited
Regulatory Status
Research Status & Regulatory Context
United States — FDA
No Approved Indication
Investigational / Research Use
No FDA-approved injectable LL-37 formulation for systemic use. Topical formulations are in clinical trial pipelines for wound healing and dermatological indications. Intranasal forms are in early research. Research-grade synthetic LL-37 is available for laboratory and investigational use.
Clinical Development
Active Phase II Trials
Multiple Active Programs
Wound healing (chronic venous leg ulcers): Phase II positive signal (Lipocalix AB, Sweden). Dry eye / ocular surface: early-phase studies. Periodontitis: topical gel formulations in trial. Oncology: early-phase studies for selected cancers. No large Phase III programs yet.
WADA Prohibited Status
Not Prohibited
Not on WADA Prohibited List
As of the current WADA Prohibited List, LL-37 is not classified as a prohibited substance. LL-37 is an endogenous antimicrobial peptide without established performance-enhancing properties. Competitive athletes should verify current WADA list status before use, as classifications change annually.
Molecular Profile
Structure & Physical Properties
Structural Feature
Amphipathic α-Helix
Hydrophobic face (membrane insertion) + cationic face (negative bacterial membrane attraction)
Sequence Length
37 Amino Acids
Starts with LL (two leucines) → "LL-37" nomenclature; C-terminal segment of hCAP18 precursor
Molecular Weight
~4,493 Da
~4.5 kDa; net positive charge (+6) at physiological pH — essential for electrostatic membrane interaction
Precursor Protein
hCAP18
18 kDa proprotein stored in neutrophil secondary granules; cleaved by proteinase 3 (PR3) → active LL-37
Natural Sources
Multi-tissue
Neutrophils (highest expression), keratinocytes (skin), respiratory epithelia, GI mucosa, genitourinary tract, NK cells, macrophages
Primary Inducer
Vitamin D3
1,25-dihydroxyvitamin D (calcitriol) binds VDR on immune cells → CAMP gene transcription → hCAP18/LL-37 production
Mechanism of Action
Four Pillars of Cathelicidin Biology
LL-37 is among the most multifunctional host defense peptides identified. Its mechanisms extend far beyond direct antimicrobial killing into immunomodulation, tissue repair, and signaling — reflecting its evolutionary role as a bridge between innate and adaptive immunity.
01
Membrane Disruption & Direct Killing
LL-37's amphipathic α-helical structure enables electrostatic attraction to negatively charged bacterial membranes (gram-positive and gram-negative). Upon contact, it inserts into the lipid bilayer, forming pores or using a "carpet model" detergent-like disruption — depolarizing the membrane and causing osmotic lysis. This mechanism is resistant to conventional antibiotic resistance mechanisms.
LL-37 modulates pattern recognition receptor signaling bidirectionally: it can both activate TLR4 (promoting innate immune responses to bacterial LPS) and simultaneously suppress excessive TLR-driven inflammation by binding and neutralizing LPS, preventing systemic inflammatory response. It promotes macrophage chemotaxis, dendritic cell maturation, and T-cell activation — linking innate to adaptive responses.
At sub-antimicrobial concentrations, LL-37 promotes wound closure through multiple pathways: EGFR transactivation (epidermal growth factor receptor) drives keratinocyte proliferation and migration; VEGF upregulation stimulates angiogenesis at the wound site; and LL-37 promotes fibroblast migration and MMP expression for extracellular matrix remodeling. The wound healing effect is concentration-dependent and distinct from its antimicrobial action.
LL-37 directly disrupts the lipid envelopes of enveloped viruses including HSV-1, RSV, and HIV-1 through the same membrane-disrupting mechanism as its antibacterial activity. Against biofilms — which are inherently resistant to conventional antibiotics — LL-37 disrupts the extracellular polysaccharide matrix and reduces quorum sensing signals, making it among the few host defense peptides with validated anti-biofilm activity at physiological concentrations.
The Vitamin D–LL-37 Axis: Innate Immunity's Master Switch
☀️
Why Vitamin D Deficiency Means Infection Vulnerability
The biochemical pathway that connects sunlight, vitamin D, and antimicrobial defense — and why it matters clinically
The VDR System
Vitamin D as an Immune Hormone
Vitamin D3 (cholecalciferol) is hydroxylated in the liver to 25-hydroxyvitamin D [25(OH)D], then in the kidney and immune cells to 1,25-dihydroxyvitamin D (calcitriol) — the biologically active form. Calcitriol binds the Vitamin D Receptor (VDR), a nuclear transcription factor present in most immune cells including neutrophils, macrophages, dendritic cells, T cells, and B cells. This VDR-calcitriol complex directly binds Vitamin D Response Elements (VDREs) in the CAMP gene promoter — the gene encoding hCAP18/LL-37.
The Induction Mechanism
How Vitamin D Makes LL-37
When 1,25(OH)₂D binds VDR on a macrophage or neutrophil, the VDR-RXR complex translocates to the CAMP gene, upregulating hCAP18 transcription within hours. Pattern recognition (TLR1/2 activation by bacterial lipoproteins) simultaneously upregulates VDR and the local 1α-hydroxylase enzyme — meaning that when a macrophage detects a pathogen, it amplifies its own LL-37 production by converting 25(OH)D to calcitriol on-site. This "autocrine immune amplification" makes circulating 25(OH)D the substrate and the rate-limiting step for infection defense: insufficient substrate (vitamin D deficiency) → insufficient LL-37 → impaired innate immunity.
Clinical Implications
From Biochemistry to Practice
This pathway explains epidemiological observations that have long puzzled clinicians: the seasonal pattern of respiratory viral infections (winter → lower UV → lower vitamin D → lower LL-37); the disproportionate infection susceptibility in vitamin D-deficient individuals; the increased tuberculosis risk in dark-skinned populations in northern latitudes (melanin reduces vitamin D synthesis); and in cystic fibrosis, where LL-37 is constitutively deficient in airways, contributing to Pseudomonas aeruginosa colonization. Multiple RCTs of vitamin D supplementation demonstrate reduced respiratory infection rates, likely partially mediated through LL-37 induction.
LL-37 In Vitro Activity — Relative MIC Efficacy vs. Pathogen Class
Efficacy ratings represent consensus from in vitro studies using physiological LL-37 concentrations (1–32 µg/mL). In vivo efficacy may differ due to salt sensitivity (high NaCl reduces activity), serum protein binding, and protease degradation in wounds. Non-enveloped viruses lack a lipid envelope and are largely unaffected by LL-37's membrane-disrupting mechanism.
Pharmacokinetics
Delivery Challenges & Pharmacokinetic Profile
LL-37's extraordinary in vitro potency contrasts sharply with its in vivo pharmacological limitations. Understanding these limitations is essential for evaluating both current investigational use and why the research field has pivoted toward analog development and topical delivery strategies.
Plasma Half-Life (Native)
< 5 minutes
In protease-rich environments (infected tissue, serum). Trypsin, elastase, and staphylococcal V8 protease rapidly cleave LL-37's arginine-rich regions
Serum Half-Life (Isolated)
~1–2 hours
In cell-free serum systems — substantially longer than in infected tissue, but still too brief for conventional systemic dosing intervals
Salt Sensitivity
> 90% loss
Antimicrobial activity loss at physiological NaCl (150 mM). Electrostatic attraction to bacterial membranes is screened by salt ions — explaining the gap between in vitro MIC data and in vivo efficacy
Serum Protein Binding
High
LL-37 binds albumin and apolipoprotein A-I; free peptide fraction available for antimicrobial action is significantly reduced in plasma
Route
Viability
Est. Half-Life
Key Limiting Factor
IV (Intravenous)
Not Viable
< 5 min
Dose-dependent hemolysis at concentrations required for systemic antimicrobial effect; rapid protease clearance before reaching target tissue
SC / IM
Research Only
Est. 1–2 hours
Degraded by tissue proteases at injection site; physiological salt in extracellular fluid suppresses antimicrobial activity; no characterized human PK data
Topical (Gel / Cream)
Clinically Viable
Hours (local)
Active clinical path — Lipocalix Phase II data positive for chronic venous ulcers; local concentrations achievable without hemolytic systemic exposure; limited tissue penetration depth
Intranasal
Research (CF/Respiratory)
Hours (mucosal)
Viable for airway infection; compromised in CF due to high NaCl inactivating LL-37 at the mucosal surface — driving development of salt-resistant analogs specifically for this route
Oral
Not Viable
< 30 min
Complete degradation by GI proteases (pepsin, trypsin, chymotrypsin) before systemic absorption; no enteric coating adequately protects a 37-aa peptide from luminal proteolysis
The In Vitro / In Vivo Gap: LL-37's in vitro MIC values (typically 1–8 µg/mL against S. aureus) are clinically compelling. But achieving and maintaining these concentrations systemically requires doses that cause hemolysis before reaching infected tissue — and the peptide's residual activity is then further suppressed by physiological NaCl concentrations. This is why a molecule with extraordinary in vitro potency has not yielded a systemic antibiotic drug after decades of research. The barriers are fundamental biophysical properties of the molecule, not simply formulation problems. The field's response — pivoting to topical delivery and structural analog engineering — represents a scientifically mature adaptation to these constraints.
Evidence Summary
Key Studies & Clinical Evidence
Study / Source
Design
Model / Population
Key Finding
Lipocalix LL-37 Wound Trial Phase II, Sweden, 2016–2019
Phase II RCT
Chronic venous leg ulcers (n=52)
LL-37 topical gel significantly improved wound closure at 12 weeks vs. placebo. Reduced bacterial burden and inflammatory markers. Most rigorous human efficacy data for LL-37 to date.
Liu et al., 2006 Science
Mechanistic
Human monocytes / macrophages
Vitamin D induces LL-37 via VDR → CAMP gene pathway, which mediates killing of M. tuberculosis. Demonstrated the biochemical mechanism linking vitamin D deficiency to TB susceptibility. Landmark mechanistic paper.
Martineau et al., 2011 BMJ (meta-analysis)
Meta-analysis RCTs
Vitamin D supplementation trials
Vitamin D supplementation significantly reduced risk of respiratory infections (OR 0.58, 95% CI 0.35–0.95) in vitamin D-deficient individuals. Effect likely partially mediated through LL-37 induction.
Heilborn et al., 2003 Journal of Investigative Dermatology
Tissue Analysis
Rosacea vs. normal skin biopsies
LL-37 and its processing enzymes (kallikrein 5) are overexpressed in rosacea skin. Abnormal LL-37 fragments (not intact LL-37) drive inflammation via TLR2 and blood vessel activation — explaining rosacea's paradoxical relationship with the peptide.
Tokumaru et al., 2005 Journal of Immunology
In Vitro
Human keratinocytes
LL-37 transactivates EGFR in keratinocytes via a metalloproteinase-dependent mechanism, driving proliferation and migration. Established the molecular basis for LL-37's wound re-epithelialization effect.
Steinstraesser et al., 2009 PLoS ONE
Animal
Mouse wound healing model
LL-37 accelerated wound closure by 35% and reduced wound infection rates in contaminated wounds. Demonstrated dual antimicrobial + wound healing benefit. Direct support for topical clinical applications.
Büchau et al., 2007 Journal of Investigative Dermatology
Cell Line Studies
Ovarian cancer cell lines
LL-37 inhibited ovarian cancer cell proliferation and induced apoptosis via FPR2 and downstream caspase activation. Part of the evidence for LL-37's anti-tumor role in selected cancer types.
Vandamme et al., 2012 Clinical Infectious Diseases
Review
Cystic fibrosis airways
CF airways show constitutively deficient LL-37 activity due to high NaCl (from CFTR dysfunction) inactivating the peptide. This is a primary mechanism explaining Pseudomonas aeruginosa colonization susceptibility in CF — a milestone in understanding LL-37's in vivo limitations.
Complex Oncological Profile
LL-37's Dual Role in Cancer Biology
LL-37's cancer biology is uniquely complex — the same peptide exhibits anti-tumor effects in some cancers and pro-tumor effects in others, through the same FPR2 receptor but divergent downstream signaling. This duality requires careful, cancer-specific analysis and makes generalized statements about LL-37 and cancer inappropriate.
Anti-Tumor Effects
Where LL-37 May Suppress Cancer
Ovarian Cancer: LL-37 induces apoptosis in ovarian cancer cell lines; lower LL-37 expression correlates with more aggressive disease; proposed as a prognostic biomarker
Hematologic Cancers: Leukemia cell lines show sensitivity to LL-37-induced apoptosis via mitochondrial pathway; proposed adjuvant to conventional chemotherapy
Melanoma: Some melanoma cell lines demonstrate growth inhibition and invasion suppression with LL-37 treatment at physiological concentrations
Proposed Mechanism: Direct membrane disruption of cancer cells (which have altered lipid compositions); immunostimulation of anti-tumor immune cells (NK cell activation, DC maturation)
Pro-Tumor Effects
Where LL-37 May Promote Cancer
Lung Cancer: LL-37 promotes non-small cell lung cancer cell invasion and metastasis via FPR2-EGFR crosstalk; overexpression correlates with worse outcomes
Gastric Cancer: LL-37 overexpression promotes gastric cancer cell migration via p38 MAPK pathway; functions as an autocrine growth factor in some gastric tumor microenvironments
Breast Cancer: Conflicting data — some studies show LL-37 promotes breast cancer cell migration and invasion; others show anti-proliferative effects depending on tumor subtype
Proposed Mechanism: FPR2-mediated EGFR transactivation (the same pathway that promotes wound healing) drives cancer cell migration; VEGF upregulation may support tumor angiogenesis
The Mechanistic Paradox: The FPR2 receptor that LL-37 binds to drive immune cell chemotaxis is the same receptor that promotes cancer cell migration in susceptible tumor types. The EGFR transactivation that drives wound healing keratinocyte migration also drives lung cancer cell invasion. LL-37 is not inherently "anti-cancer" or "pro-cancer" — it is a pleiotropic signaling peptide whose cancer biology depends entirely on the cellular context, FPR2 expression levels, downstream signaling architecture, and tumor microenvironment. Persons with active malignancy should discuss LL-37 use with their oncologist before any consideration of use.
Dermatological Context
LL-37 in Skin Biology & Inflammatory Conditions
The skin is one of the richest sites of LL-37 expression — and three major dermatological conditions each reveal a different facet of cathelicidin biology: protective function, pathological overexpression, and therapeutic application.
Rosacea
Overexpression / Dysregulation
Rosacea is paradoxically not a condition of LL-37 deficiency — it is a condition of LL-37 dysregulation. Rosacea skin shows overexpression of hCAP18 and the processing enzyme kallikrein 5 (KLK5). Abnormal KLK5 activity generates atypical LL-37 processing fragments that are not the normal, full-length LL-37 — these fragments activate TLR2, stimulate mast cell degranulation, and trigger VEGF-driven facial vessel proliferation. This generates rosacea's characteristic flushing, telangiectasia, and papulopustular presentation. Anti-rosacea treatments that reduce KLK5 activity or LL-37 processing abnormalities (azelaic acid, ivermectin) are mechanistically aligned with this pathway.
Psoriasis
Autoimmune Trigger / Complex Role
In psoriasis, LL-37 forms complexes with self-DNA released from damaged keratinocytes. These LL-37–DNA complexes act as "danger signals," activating plasmacytoid dendritic cells (pDCs) via TLR7/TLR9 to produce IFN-α, triggering the autoimmune cascade that maintains psoriatic plaques. This represents a fundamental breakdown of the boundary between innate antimicrobial defense and autoimmune pathology — LL-37 acting as a "danger sensor" rather than a pathogen killer. This mechanism makes LL-37 a drug target rather than a therapeutic in psoriasis, and raises important theoretical cautions about exogenous LL-37 in patients with psoriatic disease.
Atopic Dermatitis
Deficiency → Infection Susceptibility
Atopic dermatitis (eczema) skin shows markedly reduced LL-37 expression compared to normal skin — driven partly by the Th2-dominant cytokine milieu (IL-4, IL-13) which downregulate hCAP18 transcription. This LL-37 deficiency explains why eczematous skin is dramatically susceptible to Staphylococcus aureus colonization (contributing to 90%+ of AD cases) and to disseminated viral infections (eczema herpeticum with HSV; eczema vaccinatum with vaccinia). This is the clearest example of LL-37 deficiency as a clinical disease driver — and the strongest theoretical rationale for therapeutic LL-37 supplementation in skin conditions.
Important Dermatological Nuance: LL-37's role is diametrically opposite across these three conditions — beneficial deficiency-correction in atopic dermatitis, pathological overactivation in rosacea, and autoimmune trigger in psoriasis. This spectrum means that exogenous LL-37 could theoretically worsen rosacea and psoriasis while benefiting atopic dermatitis. Condition-specific assessment is essential before any consideration of exogenous LL-37 use in patients with inflammatory skin conditions.
Safety Monitoring
Monitoring Framework for Research Use
🔬
Baseline Immune Status
CBC with Differential
Complete blood count to characterize baseline immune cell populations. Neutrophilia or lymphopenia at baseline may indicate underlying immune dysregulation relevant to LL-37's immunomodulatory effects.
📊
Inflammatory Markers
CRP / IL-6 / ESR
Baseline inflammatory status is particularly important given LL-37's bidirectional immunomodulatory effects. Elevated baseline inflammation may amplify responses. Useful for tracking anti-inflammatory vs. pro-inflammatory trajectories during use.
☀️
Vitamin D Axis
25(OH)D + Calcium
Serum 25-hydroxyvitamin D gives context for endogenous LL-37 status. Concurrent calcium monitoring is standard when assessing vitamin D status, as calcitriol (the LL-37-inducing form) affects calcium metabolism.
🩸
Hepatic & Renal
CMP / LFTs
Standard safety panel for any peptide protocol. Renal clearance is primary for small peptides; hepatic panel to establish baseline. No known organ-specific toxicity with LL-37 but standard monitoring protocol applies to all investigational compounds.
Patient Consideration
Candidate Profile
Potentially Appropriate Candidates
Adults with chronic wound healing challenges (venous leg ulcers, diabetic wounds) under physician supervision
Individuals with documented atopic dermatitis and recurrent S. aureus colonization, where LL-37 deficiency is a known mechanism
Research participants in properly consented investigational wound-healing studies
Patients with cystic fibrosis (intranasal/inhaled research protocols specifically addressing LL-37 deficiency in airways)
Vitamin D-deficient individuals with recurrent respiratory infections — primarily via optimization of the Vitamin D → LL-37 axis through supplementation
Strong Contraindications / Avoid
Active malignancy — cancer-type-specific pro- or anti-tumor effects are incompletely understood; oncologist consultation essential
Rosacea or psoriasis — LL-37 overactivation is the disease mechanism in both; exogenous LL-37 could worsen these conditions
Active autoimmune conditions — LL-37's immunostimulatory effects could exacerbate autoimmune disease
Pregnancy or lactation — no safety data exists for systemic use
Sepsis or systemic inflammatory states — bidirectional immunomodulatory effects are unpredictable in this context
Research Frontier
Next-Generation Analogs & Engineering Strategies
LL-37's four pharmacological liabilities have driven a substantial structural engineering program. Rather than abandoning the peptide, researchers have systematically addressed each limitation through structural modifications — creating a pipeline of next-generation antimicrobial peptides that retain LL-37's mechanism while overcoming its pharmacokinetic constraints.
1
Salt Sensitivity
Positive charge screened at physiological NaCl (150 mM); >90% antimicrobial activity loss vs. low-salt in vitro conditions — the primary in vivo gap
2
Protease Susceptibility
Rapid cleavage by trypsin, elastase, KLK5, staphylococcal V8 protease; t½ <5 min in infected tissues; intact LL-37 is rarely detectable in wound fluid
3
Hemolytic Activity
At concentrations required for systemic antimicrobial efficacy, LL-37 lyses red blood cells via the same membrane-disruption mechanism — precluding IV administration
4
Protein Binding
Avid binding to plasma albumin and apoA-I sequesters free peptide; bioavailability at infectious sites is substantially lower than total plasma concentration suggests
Engineering Approaches & Research Analogs
KR-12
Truncated Fragment · AA 18–29
The smallest LL-37 fragment retaining full antimicrobial activity against gram-positive and gram-negative bacteria. Only 12 residues vs. 37; significantly reduced hemolytic activity compared to full-length LL-37 while maintaining the core amphipathic helical structure essential for membrane disruption.
Pre-Clinical
FK-13 / GI-20
Activity-Separated Fragments
Complementary truncated analogs that disaggregate LL-37's dual activities. FK-13 (AA 17–29) retains maximal membrane-disruption/antimicrobial potency. GI-20 (AA 1–20) retains superior immunomodulatory signaling (TLR modulation, chemotaxis). Used to isolate and study each function independently.
Research Tool
D-LL-37
Retro-Inverso · All D-Amino Acids
Mirror-image LL-37 with all L-amino acids replaced by D-amino acids. Creates complete protease resistance (mammalian and bacterial proteases are stereospecific; they cannot cleave D-amino acid substrates). Membrane disruption is not stereoselective, so antimicrobial activity is fully preserved — making D-LL-37 the primary tool for in vivo half-life extension studies.
Pre-Clinical
WLBU2
Salt-Resistant Engineered Peptide
De novo-designed cationic peptide specifically engineered to maintain antimicrobial activity at physiological NaCl — the primary limitation absent from native LL-37. Of particular research interest in cystic fibrosis, where airway NaCl would inactivate native LL-37. Demonstrates measurably superior salt resistance while retaining broad-spectrum antimicrobial activity.
CF Phase I Exploratory
Omiganan (MBI-226)
Indolicidin-Derived Cathelicidin AMP
Not a direct LL-37 structural analog, but part of the cathelicidin-derived antimicrobial peptide family. Reached Phase III trials for catheter-related bloodstream infections and topical rosacea therapy. The closest clinical parallel to where LL-37 research is heading — a modified cathelicidin family member that has cleared early clinical hurdles for topical indications with a tractable safety profile.
Phase III (Rosacea)
Nanoparticle LL-37
Delivery Engineering · Structural Unchanged
Encapsulation of native LL-37 in liposomes, polymeric nanoparticles, or lipid nanoparticles to protect from protease degradation, reduce hemolytic exposure, and enable controlled local release. Active research particularly for wound care and inhaled CF formulations. Addresses the delivery problem without modifying the peptide chemistry itself — preserving full LL-37 biological activity.
Pre-Clinical
The Translation Trajectory: The shift from native LL-37 research toward truncated fragments (KR-12), protease-resistant forms (D-LL-37), salt-resistant analogs (WLBU2), and nanoparticle delivery reflects a maturing understanding: LL-37's biology is the therapeutic model, but its chemistry requires re-engineering for medicine. Topical wound healing (Lipocalix, positive Phase II) and CF respiratory (intranasal, analog development) represent the two most clinically advanced trajectories — both exploiting local delivery to circumvent the pharmacokinetic barriers that prevent systemic use.
Tetrapeptide AEDG; Khavinson pineal; telomerase/TERT; NK cell enhancement
Frequently Asked Questions
LL-37 Questions Answered
What does "the only human cathelicidin" mean, and why does it matter?
Cathelicidins are a family of host defense peptides found across vertebrates. Mice have four cathelicidins (CRAMP being the most studied). Rabbits have CAP-18. Most other mammals have multiple cathelicidins. Humans, however, have just one: the CAMP gene encoding hCAP18/LL-37. This evolutionary decision concentrates all human cathelicidin function into a single molecular effector — making LL-37's expression level, processing, and activity uniquely important for human innate immunity. There is no other human cathelicidin that can compensate for LL-37 deficiency. This is why the Vitamin D → LL-37 induction pathway is so clinically significant: disrupting it (through vitamin D deficiency) eliminates the only cathelicidin defense humans possess, with no backup system.
Does taking Vitamin D increase my LL-37 levels?
Yes — in vitamin D-deficient individuals, correcting deficiency with supplemental vitamin D3 increases LL-37 expression in immune cells, particularly in neutrophils and macrophages. This is the best-documented natural approach to upregulating LL-37. The mechanism is well-characterized: calcitriol (the active form of vitamin D) binds VDR on immune cells and directly activates the CAMP gene. In individuals with adequate vitamin D status (25(OH)D ≥ 40 ng/mL), further supplementation shows diminishing returns — the CAMP gene promoter has a saturation point. The therapeutic "sweet spot" is correcting genuine deficiency (commonly defined as 25(OH)D < 20 ng/mL) to sufficiency (≥ 30 ng/mL), which consistently increases LL-37 expression in multiple studies. This is perhaps the most evidence-supported and lowest-risk approach to optimizing the LL-37 axis — more so than exogenous LL-37 supplementation.
Why does Cystic Fibrosis cause susceptibility to Pseudomonas if LL-37 is present?
This is one of the most instructive examples of in vivo LL-37 biology. Patients with cystic fibrosis have normal LL-37 gene expression and produce adequate hCAP18 protein — but the CFTR channel defect causes markedly elevated NaCl concentration in airway surface liquid. LL-37, like most cathelicidins, is highly salt-sensitive: its antimicrobial activity depends on electrostatic attraction to negatively charged bacterial membranes, which is disrupted in high-salt environments. At the elevated NaCl found in CF airways, LL-37's net positive charge is screened and its ability to insert into bacterial membranes is severely impaired — LL-37 is physically present but functionally inactivated. Pseudomonas aeruginosa, which has adapted to high-salt environments and produces alginate biofilms resistant to innate immune attack, thrives in this environment. This is why gene therapy approaches for CF focus on correcting the CFTR channel (the upstream defect) rather than simply supplementing LL-37, and why inhaled salt-resistance-engineered LL-37 analogs are an active research direction.
Is LL-37 related to the rosacea skin condition?
Yes, but in a counterintuitive way. Rosacea is not caused by LL-37 deficiency — it is caused by abnormal LL-37 processing leading to pathogenic fragments. Rosacea skin shows overexpression of both hCAP18 and the enzyme kallikrein 5 (KLK5, a serine protease). In normal skin, KLK5 generates intact, functional LL-37 that protects against pathogens. In rosacea skin, dysregulated KLK5 generates abnormal LL-37 processing fragments with different biological activities — these fragments activate TLR2 (triggering inflammation), stimulate mast cell degranulation (causing flushing), and upregulate VEGF (driving the facial telangiectasias). Triggers that increase KLK5 activity (UV exposure, heat, alcohol, spicy food, Demodex mite proteases) worsen rosacea by increasing these abnormal LL-37 fragments. This is why exogenous LL-37 would be theoretically contraindicated in active rosacea — adding substrate to an already overactive processing system.
Can LL-37 be used as an antibiotic alternative?
LL-37's membrane-disruption mechanism is theoretically less prone to conventional antibiotic resistance mechanisms — bacteria cannot easily develop efflux pumps or enzymatic inactivation against a physical membrane attack. This makes it scientifically interesting for antibiotic-resistant infections. However, several significant challenges prevent its current use as a systemic antibiotic: (1) Salt sensitivity — high NaCl conditions (like infected tissues) impair activity; (2) Serum protein binding — plasma proteins bind LL-37, reducing bioavailability; (3) Protease degradation — LL-37 is degraded by bacterial and host proteases in infected tissue; (4) Concentration-dependent toxicity — at the concentrations required for reliable in vivo bacterial killing, LL-37 can cause hemolysis and cytotoxicity; (5) No systemic human RCT data exists. Research into protease-resistant LL-37 analogs, nanoparticle delivery systems, and topical formulations continues to address these limitations — the topical wound healing application (Lipocalix) is the closest to clinical viability.
How does LL-37 interact with cancer — is it beneficial or harmful?
LL-37's cancer interactions are cancer-type specific and cannot be generalized. In ovarian cancer, hematologic malignancies, and some melanomas, LL-37 demonstrates anti-tumor properties including direct cytotoxicity and immune activation against tumor cells. In lung cancer, gastric cancer, and some breast cancer subtypes, LL-37 appears to promote tumor cell migration, invasion, and potentially angiogenesis through FPR2-EGFR crosstalk and VEGF upregulation — the same pathways that make it effective for wound healing become problematic in these contexts. The FPR2 receptor is the key variable: its expression level and downstream coupling differ between normal cells, anti-tumor-susceptible cancer cells, and pro-tumor-susceptible cancer cells. This means that any research use of LL-37 in individuals with active or past malignancy requires oncologist involvement and tumor-type-specific evaluation. Broad statements that LL-37 is "anti-cancer" or "pro-cancer" are both incorrect.
Is LL-37 legal to purchase for research use?
LL-37 is an endogenous human peptide, not a scheduled or controlled substance, and it is not on the WADA Prohibited List (see Regulatory Status above). Research-grade synthetic LL-37 is sold by peptide suppliers for laboratory and investigational use, but no formulation is approved for human self-administration in the United States, and legal status for purchase, possession, and use can vary by country and by intended application. Anyone considering LL-37 in a research context should confirm current regulations in their jurisdiction and consult a physician before proceeding.
What does the research actually show about LL-37's antimicrobial and immune role?
In vitro and animal studies show LL-37 kills gram-positive and gram-negative bacteria through direct membrane disruption, reduces biofilm formation, and neutralizes enveloped viruses by the same mechanism (see the Antimicrobial Activity chart above). It also functions as an immunomodulator — activating neutrophil and dendritic cell chemotaxis via FPR2, neutralizing bacterial LPS, and transactivating EGFR to drive wound re-epithelialization. The evidence base is strongest at the mechanistic and in vitro level; human efficacy data remains limited to early-phase and Phase II topical trials (see Evidence Summary above), so these findings should be read as research findings rather than a demonstrated clinical benefit.
Is LL-37 FDA-approved as a therapeutic?
No. As outlined in the Regulatory Status section above, no FDA-approved injectable or systemic LL-37 formulation exists for any indication. Topical LL-37 gel has produced positive Phase II data for chronic venous leg ulcers, and early-phase studies are underway for other applications, but none has received FDA marketing approval. Currently, LL-37 is available only as a research-grade synthetic peptide for laboratory and investigational use, not as an approved drug.
What is the human clinical trial status for LL-37?
Human trials remain limited and mostly early-phase. The most advanced program is the Lipocalix Phase II randomized controlled trial of topical LL-37 gel for chronic venous leg ulcers, which showed improved wound closure versus placebo (see Evidence Summary above). Additional early-phase studies are exploring topical or intranasal LL-37 for dry eye, periodontitis, cystic fibrosis-related airway infection, and select oncology indications. No Phase III program has been completed, and there is no published human trial data for systemic (injectable) administration.
What are the main safety concerns with LL-37?
LL-37's safety profile is shaped by its underlying pharmacology: at concentrations needed for reliable antimicrobial effect, it can cause dose-dependent hemolysis and cytotoxicity, which is a key reason intravenous administration is considered not viable (see Pharmacokinetics above). Its cancer-context-dependent and immunomodulatory effects mean it may be inappropriate for people with active malignancy, autoimmune disease, rosacea, or psoriasis (see Candidate Profile above), and no systemic human safety data exists. Because no dosing protocol has been established outside controlled investigational settings, anyone considering LL-37 in a research context should discuss the risks with a qualified physician first.
How does LL-37 differ from other antimicrobial peptides being researched?
LL-37 is the only cathelicidin that humans naturally produce, whereas many other research antimicrobial peptides — defensins, magainins, or engineered peptides like WLBU2 — are non-human, synthetic, or represent one member of a larger family found in other species. Compared to the related cathelicidin-derived compound omiganan, which has advanced further into Phase III trials for topical indications, native LL-37 carries greater salt sensitivity and protease vulnerability (see Analog Pipeline above). This is why current research increasingly centers on truncated fragments like KR-12, protease-resistant D-amino acid forms, and salt-resistant engineered analogs rather than native LL-37 itself.
Full Research Disclaimer
LL-37 (Cathelicidin hCAP18) is not approved by the U.S. Food and Drug Administration for systemic human use. No injectable formulation holds FDA approval. Topical formulations are investigational. All content on this page is provided for educational and informational purposes only and does not constitute medical advice, diagnosis, or treatment recommendations. The pharmacological complexity of LL-37 — particularly its cancer-type-specific dual roles and its opposing effects in different inflammatory skin conditions — makes physician consultation especially important before any research use. Individual response varies. Regulatory status and clinical evidence continue to evolve. PeptideReport.ai does not manufacture, sell, or endorse any peptide preparation. Verify vitamin D supplementation safety with a physician, particularly in individuals with conditions affecting calcium metabolism, granulomatous diseases, or kidney disease.
SD
Dr. Scott DelBoccio, DMD
Founding Author · PeptideReport.ai
Dr. Scott DelBoccio, DMD is a retired dentist with thirty years of clinical practice — including a hormone-therapy and regenerative wellness practice built around individual bloodwork, national lecturing on advanced dental and surgical techniques, mentoring new dentists on practice management, and innovating dental and laser procedures now used throughout North America — who is now heavily involved in peptide research and development, building beginner-to-advanced optimization frameworks calibrated to the individual, and holds workshops and lectures on peptide therapeutics for other clinicians and researchers. PeptideReport.ai was founded on the principle that E-E-A-T-compliant, physician-authored content is the appropriate standard for research-grade health information — particularly in the rapidly evolving peptide research space where accurate mechanistic understanding matters most. All compound profiles on this platform are research literature reviews, not clinical guidance.